Detalles de la compañía
  • Conbott Pharmtech Co.,Ltd.

  •  [Zhejiang,China]
  • Tipo de Negocio:Fabricante
  • Main Mark: África , Américas , Asia , caribe , Europa del este , Europa , medio Este , norte de Europa , Oceanía , Otros Mercados , Europa occidental , En todo el mundo
  • Exportador:71% - 80%
  • certs:COS, ISO9001, ISO14010, FDA
  • Descripción:106612-94-6,CAS 106612-94-6,Nº CAS 106612-94-6
Conbott Pharmtech Co.,Ltd. 106612-94-6,CAS 106612-94-6,Nº CAS 106612-94-6
Título
  • Título
  • Todas
PRODUCTOS POR GRUPO
Servicio en línea
http://es.conbottpharm.comEscanea el código QR
Inicio > Lista de Productos > Síntesis de péptidos > 99% Human Growth Hormone Peptide GLP-1 CAS 106612-94-6

99% Human Growth Hormone Peptide GLP-1 CAS 106612-94-6

Compartir:  
    Tipo de Pago: T/T,L/C
    Cantidad de pedido mínima: 1 Gram
    Plazo de entrega: 10 días
  • Mr. Tommy

Información básica

Modelo: 106612-94-6

Información adicional

Paquete: Según sea necesario

productividad: Customized

Marca: Conbottpharm

transporte: Ocean,Air

Lugar de origen: China

Capacidad de suministro: Commercial

Certificados : Documents Support

DDescripción

Ofrecemos gran calidad y alta pureza de GLP-1 CAS 106612-94-6. Glucagon como el péptido -1 (GLP-1) es una secreción intestinal de los péptidos intestinales de las células endocrinas ileales, en la actualidad principalmente como un objetivo de la diabetes tipo 2 la acción del fármaco. La ventaja de GLP-1 CAS 106612-94-6 puede reducir la inhibición del vaciado gástrico, la peristalsis intestinal. Esto proporciona una muy buena perspectiva para el tratamiento de la diabetes mellitus tipo 2. Pero debido a GLP-1 es un polipéptido, no se puede administrar por vía oral es una deficiencia importante. Estamos hábil para producir GLP alta pureza 1. Podemos proporcionar diferentes envases para satisfacer el requisito de clientes.


Thera. Categoría: Lucha contra la diabetes de tipo 2

No CAS. : 106612-94-6

Sinónimo: proglucagón (78-108) (humano, bovino, Guinea cerdo, ratón, rata); Preproglucagón 78-108 HUMANA; Preproglucagón (98-128) (humano, bovino, Guinea cerdo, ratón, rata); Insulinotropina (humano, bovino, Guinea cerdo, ratón, rata); GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP- LEU-VAL-LYS-GLY-ARG-Gly; GLU-GLY-GLN-ALA-LYS-GLU-PHE-ILE-ALA-H-HIS-AL-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR- TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH; HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG; GLP - 1 (HUMANO, 7 - 37) (BOVINO, CANINO, RATA, CERDO DE GUINEA)


106612-94-6


Fórmula molecular: C151H228N40O47

Molecular t Pesar: 3355.67

Ensayo. ≥99%

Embalaje: embalaje de exportación digna

Hoja de datos de seguridad lMaterial: disponible bajo petición

Uso: GLP-1, obviamente, puede mejorar la glucosa en la sangre en modelos animales de diabetes tipo 2 o pacientes a través de una variedad de mecanismos, que promueven la regeneración y reparación de las células beta de los islotes, aumentar el número de células beta es el papel particularmente significativo


PRODUCTOS POR GRUPO : Síntesis de péptidos

Imagen de Producto
  • 99% Human Growth Hormone Peptide GLP-1 CAS 106612-94-6
Contactar proveedor
  • *Asunto:
  • *Mensajes:
    Su mensaje debe ser de entre 20 a 8,000 caracteres.

Sitio Web Mobile índice. Mapa del sitio


Suscríbete a nuestro boletín:
¡Obtén actualizaciones, ofertas especiales, grandes premios y descuentos!

MultiLanguage:
Copyright © 2019 Conbott Pharmtech Co.,Ltd. Todos los derechos reservados.
Contactar Proveedor?Proveed
Tommy Mr. Tommy
¿Qué puedo hacer por ti?
Contactar Proveedor